PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0740s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 740aa    MW: 81434 Da    PI: 9.9395
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0740s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.91e-1431119598
                          -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                   B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                          l+ +++ + + l +p k ++++++  e s+ +tl+ ++gr+W++kl   k +g+ ++l++ W eF k   +++g  +vF+++g+s+f   
  Kaladp0740s0003.1.p  31 LVVASMIRDNKLKIPGKVVRKIEQ--ELSIVVTLTVPDGRKWNMKL--GKDDGGkCWLGDSWVEFMKHYSVRVGYLLVFRYKGDSTF--A 114
                          55667788889***********84..599*****************..6666656****************************9999..8 PP

                          EEEE- CS
                   B3  94 vkvfr 98 
                          v vf+
  Kaladp0740s0003.1.p 115 VNVFD 119
                          88887 PP

2B357.42.7e-18637724798
                          .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                           s+  k+g l +p kfa ++ ++  +s   tle+++g++Wev++    +  r++l++GW +F+ +n+LkegD++ F+l ++ ++ l+v++
  Kaladp0740s0003.1.p 637 ASYLQKKGYLHMPAKFAMKYLKE--TSGRATLENSEGKQWEVRI--GSSNVRITLSQGWHQFAMDNHLKEGDTCNFELLDSVNTLLKVTF 722
                          6888999**********999533..4558***************..888889*************************9887555577777 PP

                          E- CS
                   B3  97 fr 98 
                          +r
  Kaladp0740s0003.1.p 723 VR 724
                          66 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.4E-1823120IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-1924120IPR015300DNA-binding pseudobarrel domain
CDDcd100175.82E-1627119No hitNo description
PROSITE profilePS5086312.42127121IPR003340B3 DNA binding domain
SMARTSM010193.7E-1128121IPR003340B3 DNA binding domain
PfamPF023626.5E-1231119IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-21626720IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-21626725IPR015300DNA-binding pseudobarrel domain
CDDcd100175.14E-18629724No hitNo description
PROSITE profilePS5086314.903631726IPR003340B3 DNA binding domain
SMARTSM010191.5E-12632726IPR003340B3 DNA binding domain
PfamPF023623.4E-16637724IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MAKDDADADK DTDHTISGSS ARGKPLLFYK LVVASMIRDN KLKIPGKVVR KIEQELSIVV  60
TLTVPDGRKW NMKLGKDDGG KCWLGDSWVE FMKHYSVRVG YLLVFRYKGD STFAVNVFDL  120
SSAEIQYSVG GCEKVGEDKE PAMKNGKRSG NVRTKMTSGS EKVGQDKKFP VTKGSGSGNE  180
RVRKKPGSAK NRGKKVREGK ESVNGGTGKK LGSKDVEDDE LYLLKEDEET GNDGANKKLG  240
SSQQMPGVVC GLRSNLIEFH TECMSQIEFL NGGSEKVRLE KQSSMNNDGA RNRSGSANIR  300
QENQCTVSNG IESERDVNWK NLAMCPPGFA PKSSQQMAGM DHGVSPQSKL GESHTEFLAQ  360
TKNHRGGSSC AVEKQVKPGR GADSLGGSFP LVKDVTLGYY RANVMKSKEK KPARVRKVRN  420
PRPKNPGRDR LGLGKGGVRL NSPAKEKLTP EMPISKMARE VALLADQVSV DAKCEGRPLD  480
HMPSAADGVE VKLPVPQKLT SETQLCKQAM NVASPGLMAE DSTLHLETDQ LGTGFMTAEV  540
KSDFPPEEPL LVMITDRTRL DSTRTPVKRK KEMNISDLLD QTLPMTLAIK QEAEVNKSDL  600
ICRTTAKTAA SQKKLKSIQL SEIPHRHNPY CTVHVRASYL QKKGYLHMPA KFAMKYLKET  660
SGRATLENSE GKQWEVRIGS SNVRITLSQG WHQFAMDNHL KEGDTCNFEL LDSVNTLLKV  720
TFVRSPKEPP PPNQEVLKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A9e-1960772425141B3 domain-containing transcription factor VRN
4i1k_B9e-1960772425141B3 domain-containing transcription factor VRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-30B3 family protein